Updated Weekly

Fold the News

Every Monday, SciRouter folds the protein from the biggest biology paper of the week. Pre-rendered, pre-folded, ready to explore.

This week's foldApril 7, 2026

Cryo-EM structure of the human GLP-1R / glucagon-like peptide-1 complex

Chen et al. • Nature

Protein

GLP-1 Receptor (extracellular domain)

Length

463 residues

ESMFold pLDDT

0.89

The highest-resolution structure ever solved for the GLP-1 receptor, the target of Ozempic and Mounjaro. SciRouter folded the extracellular domain in 12 seconds on ESMFold.

Why it matters

With >$15B/year in Ozempic sales and a crowded pipeline, every medchem team is trying to design better GLP-1 agonists. This structure is the new gold standard reference.

MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQG...
Read the paperDesign a binder against this →

Recent weeks

March 31, 2026Science

De novo design of potent cancer neoantigen binders

Designed neoantigen binder • 78 residues • pLDDT 0.93

Paper
March 24, 2026Cell

Single-particle cryo-EM of the SARS-CoV-2 spike JN.1 variant

SARS-CoV-2 JN.1 Spike RBD • 223 residues • pLDDT 0.91

Paper

Want to fold your own proteins?

SciRouter has ESMFold, Boltz-2, Chai-1, and 20+ other models available through one API key. Start with 500 free credits.