Boltz-2 vs AlphaFold3: Biomolecular Complex Prediction Compared

Two Approaches to Complex Prediction

AlphaFold3 and Boltz-2 represent the current state of the art in biomolecular complex structure prediction. Both use diffusion-based generative models to predict the 3D geometry of molecular complexes involving proteins, nucleic acids, and small molecules. Despite sharing similar architectural principles, they differ significantly in accessibility, licensing, and practical usability.

This comparison covers the technical differences, benchmark results, and practical considerations that matter when choosing between the two for research or production workflows.

AlphaFold3: DeepMind's Closed Model

AlphaFold3 was published by Google DeepMind in May 2024 in Nature. It extends the AlphaFold series from single-chain protein folding to general biomolecular complex prediction. The model handles proteins, DNA, RNA, small molecules, ions, and post- translational modifications.

• Developer: Google DeepMind / Isomorphic Labs
• Architecture: diffusion-based generative model with Pairformer attention
• Weights: not publicly available (closed source)
• Access: AlphaFold Server (alphafoldserver.com) with daily prediction limits
• License: non-commercial research only via the server; no local deployment
• Inputs: protein, DNA, RNA, small molecules, ions, modified residues

Boltz-2: MIT's Open-Source Alternative

Boltz-2 was developed by researchers at MIT and released as a fully open-source model with downloadable weights. It reproduces the core architectural ideas from AlphaFold3 and achieves comparable accuracy on standard benchmarks while removing all access restrictions.

• Developer: MIT (Genesis Therapeutics collaboration)
• Architecture: diffusion-based generative model with pairwise attention
• Weights: publicly available (open source)
• Access: local GPU deployment or SciRouter API
• License: open source, commercial use permitted
• Inputs: protein, DNA, RNA, small molecules

Accuracy Comparison

Protein-Protein Complexes

On protein-protein interface prediction benchmarks, both models achieve DockQ scores above 0.5 for most heterodimer targets. AlphaFold3 shows a slight advantage on targets with limited evolutionary information, while Boltz-2 performs comparably on well-characterized protein families.

Protein-Ligand Complexes

For protein-small molecule complex prediction, Boltz-2 and AlphaFold3 produce ligand binding poses within 2 angstroms RMSD of the crystal pose for approximately 40 to 50 percent of targets. This is a challenging task, and both models represent a significant improvement over traditional docking for blind binding pose prediction.

Nucleic Acid Complexes

AlphaFold3 was specifically highlighted for its accuracy on protein-DNA and protein-RNA complexes. Boltz-2 also supports these input types and performs well, though detailed comparative benchmarks are still emerging.

Practical Differences

• API access: Boltz-2 is available through the SciRouter API for programmatic use; AlphaFold3 is only accessible via a web interface with manual submission
• Batch processing: Boltz-2 via API supports parallel job submission for screening campaigns; AlphaFold Server has daily limits
• Commercial use: Boltz-2 is freely usable in commercial drug discovery; AlphaFold3 is restricted to non-commercial research
• Customization: Boltz-2 weights can be fine-tuned on proprietary data; AlphaFold3 cannot be modified
• Reproducibility: Boltz-2 results are fully reproducible with local deployment; AlphaFold Server versions may change without notice

Using Boltz-2 via SciRouter API

Here is a complete example of predicting a protein-ligand complex structure using Boltz-2 through the SciRouter API:

import requests
import time

API_KEY = "sk-sci-your-api-key"
BASE = "https://api.scirouter.ai/v1"
headers = {"Authorization": f"Bearer {API_KEY}"}

# Predict a kinase-inhibitor complex
response = requests.post(
    f"{BASE}/proteins/complex",
    headers=headers,
    json={
        "model": "boltz2",
        "chains": [
            {
                "type": "protein",
                "sequence": "MKKFISFLLTATAAVSGAPVQGEEKLVETDPKQLISGKLNVSKATYKEL"
            }
        ],
        "ligands": [
            {"smiles": "CC1=C(C=C(C=C1)NC(=O)C2=CC=C(C=C2)CN3CCN(CC3)C)NC4=NC=CC(=N4)C5=CN=CC=C5"}
        ]
    }
)
job_id = response.json()["job_id"]

# Poll for results
while True:
    result = requests.get(
        f"{BASE}/proteins/complex/{job_id}",
        headers=headers
    ).json()
    if result["status"] == "completed":
        print(f"Complex predicted. Confidence: {result['confidence']:.2f}")
        print(f"Interface pTM: {result['interface_ptm']:.2f}")
        with open("complex.pdb", "w") as f:
            f.write(result["pdb"])
        break
    elif result["status"] == "failed":
        print(f"Error: {result['error']}")
        break
    time.sleep(10)

When to Use Which

The choice between AlphaFold3 and Boltz-2 depends on your specific situation:

• Use AlphaFold3 if you are doing non-commercial academic research, need a quick one-off prediction, and are comfortable with a web interface
• Use Boltz-2 if you need API access, batch processing, commercial use rights, reproducible results, or the ability to fine-tune the model
• Use both as a consensus approach: run both models and compare results to increase confidence in predictions

Try Boltz-2 from the SciRouter tools page. For more background on how Boltz-2 works, read our introduction to Boltz-2.