PeptidesPeptide Lab

LL-37: The Human Antimicrobial Peptide Explained

LL-37 is a 37-residue cathelicidin that kills bacteria, fungi, and viruses by disrupting their membranes — while also signaling to the human immune system. Here's the structure, mechanism, and therapeutic future.

SciRouter Team
April 10, 2026
11 min read

Long before the modern antibiotic era, multicellular organisms were running their own chemical defense programs. Most of them still do. At the front line of the human version is a family of small cationic peptides called antimicrobial peptides (AMPs), and at the center of our AMP arsenal is a single molecule: LL-37.

LL-37 is the only cathelicidin encoded by the human genome. It is 37 residues long, positively charged, amphipathic when helical, broadly active against bacteria and fungi, and deeply involved in immune signaling. It is also one of the most studied AMPs in the world — a natural starting point for any researcher interested in peptide-based antimicrobials.

The sequence and where it comes from

LL-37's primary structure is:

  • [LL-37, 37 aa]

The name reflects the first two residues — two leucines, “LL” — followed by the peptide length, 37. Those two N-terminal leucines are not an accident of evolution; they anchor the peptide into lipid membranes and drive the initial association with bacterial surfaces.

LL-37 does not exist in its active form by default. It is stored as part of a larger precursor protein called hCAP-18 (human cationic antimicrobial protein, 18 kilodaltons), encoded by the CAMP gene. The N-terminal portion of hCAP-18 is a cathelin domain — a structural hallmark of the cathelicidin family — and the C-terminal 37 residues are the mature LL-37 peptide. Proteases at sites of infection, most notably neutrophil proteinase 3, cleave LL-37 free from the precursor and release it into the extracellular space.

Expression is widespread across immune and epithelial compartments:

  • Neutrophils (stored in secondary granules as hCAP-18)
  • Keratinocytes in the skin
  • Epithelial cells of the respiratory and urogenital tracts
  • Monocytes, macrophages, and some lymphocyte subsets

The amphipathic alpha helix

In aqueous solution, LL-37 is largely disordered. Put it near a lipid membrane — especially a negatively charged bacterial membrane — and it folds into an alpha helix. That transition from disorder to order is a key feature of many AMPs, and it is how LL-37 converts from a benign peptide in plasma into a membrane-perturbing weapon at the bacterial surface.

Drawn onto a Schiffer-Edmundson helical wheel, the helical form of LL-37 reveals its amphipathic character: hydrophobic residues (leucines, phenylalanines, isoleucines, valines) cluster on one face, while positively charged residues (arginines and lysines) cluster on the opposite face. This asymmetric chemistry is the engine of LL-37's antimicrobial activity.

You can see the helical wheel of LL-37, rotate its backbone ribbon, and see per-residue charge and hydrophobicity in the Peptide Lab LL-37 workspace.

How LL-37 kills bacteria

The membrane-disruption mechanism of LL-37 follows a multi-step pattern that several AMPs share:

1. Electrostatic attraction

Bacterial outer leaflets are rich in negatively charged lipids — lipopolysaccharide in Gram-negatives, teichoic acids in Gram-positives. The positively charged face of LL-37 is drawn to these surfaces by simple electrostatics. Mammalian cell membranes, by contrast, expose mostly zwitterionic phospholipids on their outer leaflet and are less attractive targets.

2. Helical insertion

Once associated with the membrane, LL-37 folds into its alpha helix and partially embeds, orienting its hydrophobic face into the lipid core and its charged face toward the aqueous solvent.

3. Membrane disruption

At sufficient peptide concentration, LL-37 destabilizes the lipid bilayer. Several models have been proposed — toroidal pores, carpet-like disruption, or more complex dynamic arrangements — and the mechanism likely depends on lipid composition and peptide concentration. The net effect is membrane permeabilization, leakage of cellular contents, and bacterial death.

4. Secondary intracellular effects

LL-37 can also reach the bacterial cytoplasm and interact with intracellular targets, including nucleic acids and metabolic proteins. Whether this is a primary or secondary contributor to killing is still debated.

Activity beyond bacteria

Calling LL-37 just an antibacterial peptide dramatically understates it:

  • Antifungal activity. LL-37 kills several yeast and fungal species in vitro, including Candida albicans, by similar membrane-disruption mechanisms adapted to fungal cell walls and membranes.
  • Antiviral activity. Against enveloped viruses, including influenza, LL-37 can directly disrupt the viral envelope and block infection.
  • Immunomodulation. LL-37 interacts with formyl peptide receptor-like 1 (FPRL1) on immune cells, influences chemotaxis of neutrophils and monocytes, modulates cytokine release, and shapes the response to lipopolysaccharide.
  • Wound healing. Keratinocytes upregulate LL-37 expression during skin repair. It promotes cell migration and angiogenesis in that context.

These roles reframe LL-37 as a host-defense peptide rather than a simple antibiotic. It is a signaling molecule as much as a killing molecule, and that dual nature shapes both its therapeutic promise and its challenges.

The vitamin D connection

The CAMP gene promoter contains a vitamin D response element. When vitamin D binds its receptor in certain cell types — notably macrophages and keratinocytes — it can upregulate LL-37 transcription. This is a concrete molecular link between vitamin D status and innate immune competence, and it helps explain why vitamin D deficiency has been epidemiologically linked to susceptibility to certain infections.

It is worth being careful about what this does and does not prove. The gene-level connection is real. Whether vitamin D supplementation at typical population doses meaningfully changes LL-37-driven antimicrobial activity in healthy adults is a more complex question with mixed clinical evidence.

Therapeutic potential and hurdles

LL-37 looks like a dream drug on paper: broad-spectrum, multiple mechanisms, human-derived so unlikely to be immunogenic, and active against organisms that resist conventional antibiotics. Translating that into an approved therapy has been much harder.

Several persistent hurdles get in the way:

  • Cytotoxicity. At concentrations high enough for robust antibacterial killing, LL-37 can also damage mammalian cells. The therapeutic window is narrow.
  • Protease susceptibility. Like most natural peptides, LL-37 is degraded by host and microbial proteases, limiting its systemic half-life.
  • Delivery. Intravenous delivery is impractical at therapeutic doses. Topical and localized delivery (wound dressings, inhaled formulations) are more promising routes.
  • Manufacturing. Solid-phase synthesis of 37-residue peptides at pharmaceutical quality is expensive relative to small-molecule antibiotics.

These are the problems that drive the ongoing interest in LL-37-inspired analogs, truncated fragments, D-amino acid variants, and rationally designed mimetics. The goal is to capture the antimicrobial and immunomodulatory functions while tuning down cytotoxicity and protease sensitivity.

Note
Peptide Lab's mutation suggester is a fast way to explore LL-37 variants. Pick a property target — lower hydrophobicity, adjusted charge — and rank single-residue substitutions. It is a gateway to rational AMP design without leaving the browser.

Explore LL-37

If you want to see the helical wheel, the per-residue charge strip, the Kyte-Doolittle hydrophobicity profile, and run an ESMFold prediction on LL-37:

Open the LL-37 workspace →

Or browse the full antimicrobial peptide category in Peptide Lab.

Frequently Asked Questions

What is LL-37?

LL-37 is the only cathelicidin-family antimicrobial peptide encoded by the human genome. It is a 37-residue alpha-helical peptide released by proteolytic processing of the precursor protein hCAP-18 (human cationic antimicrobial protein, 18 kDa). It plays a broad role in innate immunity.

Where does LL-37 come from in the body?

LL-37 is produced by neutrophils, epithelial cells in the skin and airways, monocytes, macrophages, and some lymphocytes. It is stored as the inactive precursor hCAP-18 and cleaved to the mature LL-37 peptide by proteases such as proteinase 3 at sites of infection or injury.

Why is LL-37 called amphipathic?

When LL-37 folds into an alpha helix (which it does in the presence of a lipid membrane), its hydrophobic residues cluster on one face of the helix and its positively charged residues cluster on the other. That asymmetric charge and hydrophobicity distribution is what 'amphipathic' means, and it is central to how the peptide interacts with bacterial membranes.

Does LL-37 work against viruses?

In vitro, LL-37 shows activity against several enveloped viruses, including influenza. The mechanisms involve direct disruption of the viral envelope and modulation of host immune responses. Translating these findings into clinical antiviral therapies has been challenging because of peptide stability, toxicity, and delivery issues.

Is LL-37 related to vitamin D?

Yes. The CAMP gene that encodes LL-37 has a vitamin D response element in its promoter. Activation of the vitamin D receptor in certain immune and epithelial cells upregulates CAMP transcription, which is one reason vitamin D status has been linked to innate immune competence. This is a genuine molecular-level connection, not just a correlation.

Why isn't LL-37 a clinical antibiotic yet?

Several reasons: it can be cytotoxic to human cells at the concentrations needed for robust antimicrobial activity, it is susceptible to protease degradation, systemic delivery is difficult, and manufacturing at scale is expensive. Researchers continue to explore analogs, fragments, and formulations that preserve the useful functions while reducing the liabilities.

Can I view LL-37's structure in Peptide Lab?

Yes. Peptide Lab has a dedicated LL-37 workspace showing the sequence, helical wheel projection, hydrophobicity profile, and a one-click ESMFold structure prediction. Because LL-37 is substantially helical, ESMFold pLDDT scores are typically meaningful.

Try this yourself

500 free credits. No credit card required.