LabsHybrid40 credits

BindCraft — End-to-End Binder Discovery Pipeline

One-shot binder design: BoltzGen → Boltz-2 → ProteinMPNN → ranked candidates

BindCraft chains BoltzGen generation, Boltz-2 structural validation, ProteinMPNN refinement, and composite ranking into a single API call. Published wet-lab hit rates range from 10-100%. Submit a target sequence and optional hotspots; receive a ranked set of validated binder candidates with predicted wetlab success probability.

$0.40

per API call

credits per call

/v1/labs/binder/discover

API endpoint

Features

End-to-end pipeline: generation → validation → refinement → ranking

4-stage workflow with per-stage candidate counts

Composite score combining Boltz-2 ipTM, MPNN, and ΔG

Predicted wetlab success probability per design

Interface residue identification

Async job pattern with detailed stage tracking

Quick Start

BindCraft — Python Examplepython

import requests

API_KEY = "sk-sci-your-key-here"

# Run BindCraft against PD-L1
resp = requests.post(
    "https://scirouter.ai/v1/labs/binder/discover",
    json={
        "target_sequence": "FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSS...",
        "hotspots": [42, 67, 89],
        "num_designs": 5,
    },
    headers={"Authorization": f"Bearer {API_KEY}"}
)
job = resp.json()["data"]
result = job["result"]

print(f"Pipeline stages:")
for stage in result["pipeline_stages"]:
    print(f"  {stage['stage']}: {stage['candidates']} candidates")

print(f"Top 3 designs:")
for d in result["designs"][:3]:
    print(f"  {d['design_id']}: composite={d['composite_score']} wetlab_pred={d['predicted_wetlab_success']}")