ESMFold vs AlphaFold vs Boltz-2: Which Protein Folding Tool in 2026?

The Protein Folding Landscape in 2026

Protein structure prediction has matured rapidly since AlphaFold2's breakthrough in 2020. In 2026, researchers and developers face a genuine choice between multiple production-ready tools, each with distinct strengths. The three leading options – ESMFold, AlphaFold3, and Boltz-2 – represent fundamentally different approaches to the same problem, and choosing the right one can save hours of compute time and thousands of dollars.

This guide provides a head-to-head comparison across accuracy, speed, capabilities, licensing, and practical API access. Whether you are building a drug discovery pipeline, screening protein variants, or integrating structure prediction into an automated workflow, you will find concrete guidance on which tool fits your use case.

The Three Contenders

ESMFold – Speed-First Single-Chain Prediction

ESMFold, developed by Meta AI, takes a radically different approach from AlphaFold. Instead of searching sequence databases to build multiple sequence alignments (MSAs), ESMFold uses a protein language model (ESM-2 with 15 billion parameters) to predict structure directly from a single amino acid sequence. This eliminates the MSA bottleneck entirely.

• Architecture: ESM-2 language model + folding head (no MSA required)
• Speed: 1–10 seconds for typical proteins (under 500 residues)
• Accuracy: Comparable to AlphaFold2 on well-folded single-chain proteins with high-confidence predictions
• Limitations: Single chains only, no complex prediction, lower accuracy on proteins with few homologs
• License: MIT – fully open source, commercial use permitted
• GPU requirement: A100 40GB or higher for inference

AlphaFold3 – The Accuracy Benchmark

AlphaFold3, from Google DeepMind and Isomorphic Labs, extends AlphaFold2 to predict the structure of biomolecular complexes – proteins with ligands, nucleic acids, ions, and post-translational modifications. It introduced a diffusion-based architecture that generates all-atom coordinates rather than just backbone frames.

• Architecture: MSA-based + diffusion module for all-atom generation
• Speed: 5–30 minutes (dominated by MSA search), plus inference
• Accuracy: State of the art on CASP15 complexes, highest accuracy on protein-ligand interfaces
• Capabilities: Proteins, ligands, DNA, RNA, ions, covalent modifications
• License: Restricted – academic use only, no commercial redistribution
• Access: AlphaFold Server (free, rate-limited) or self-hosted with license restrictions

Boltz-2 – Open-Source Complex Prediction

Boltz-2, from the MIT Jameel Clinic, is the leading open-source alternative to AlphaFold3. It predicts the same types of biomolecular complexes – protein-protein, protein-ligand, protein-nucleic acid – with accuracy that matches or exceeds AlphaFold3 on several benchmarks, all under a fully permissive MIT license.

• Architecture: MSA-based + confidence-conditioned diffusion
• Speed: 5–25 minutes (MSA search + inference), comparable to AlphaFold3
• Accuracy: Matches AlphaFold3 on protein-ligand docking (PoseBusters benchmark), exceeds on some protein-protein benchmarks
• Capabilities: Proteins, ligands, DNA, RNA, covalent modifications, glycans
• License: MIT – fully open source, commercial use permitted
• GPU requirement: A100 80GB recommended for complex prediction

Head-to-Head Benchmark Comparison

The following benchmarks are drawn from published results on standard evaluation datasets. Numbers represent GDT-TS for single-chain proteins and DockQ/LDDT for complexes, measured on CASP15 and PoseBusters test sets.

Single-Chain Protein Structure (CASP15 Targets)

For monomeric proteins, all three tools produce high-quality predictions on well-folded domains. The key differences emerge on difficult targets with few sequence homologs.

• AlphaFold3: GDT-TS 87.2 (median), highest accuracy on difficult targets with sparse MSAs
• Boltz-2: GDT-TS 85.8 (median), within 2 points of AlphaFold3 on most targets
• ESMFold: GDT-TS 82.4 (median), competitive on high-confidence predictions but drops on orphan proteins

Protein-Ligand Complex Prediction (PoseBusters)

Complex prediction is where AlphaFold3 and Boltz-2 separate from ESMFold, which cannot predict complexes at all.

• AlphaFold3: 76% success rate (RMSD under 2 Angstrom on PoseBusters)
• Boltz-2: 78% success rate – slightly higher than AlphaFold3 on this benchmark
• ESMFold: Not applicable – single-chain only

Protein-Protein Interface Prediction

• AlphaFold3: DockQ 0.68 (median on heterodimers)
• Boltz-2: DockQ 0.71 (median on heterodimers)
• ESMFold: Not applicable – cannot predict multi-chain assemblies

Speed and Cost Comparison

Speed is where the three tools differ most dramatically. For high-throughput screening applications, the difference between 5 seconds and 15 minutes per prediction completely changes what is practical.

Inference Time (300-Residue Single-Chain Protein)

• ESMFold: ~3 seconds (no MSA required)
• AlphaFold3: ~12 minutes (8 min MSA search + 4 min inference)
• Boltz-2: ~10 minutes (7 min MSA search + 3 min inference)

Throughput at Scale

If you need to screen 10,000 protein variants – a common requirement in directed evolution campaigns or mutational scanning – the time differences are stark:

• ESMFold: ~8 hours on a single A100 GPU
• AlphaFold3: ~83 days on a single A100 GPU (impractical without massive parallelism)
• Boltz-2: ~69 days on a single A100 GPU (similarly impractical for large-scale screening)

Running All Three Through SciRouter

SciRouter provides unified API access to both ESMFold and Boltz-2. Here is how to submit the same protein sequence to both models and compare their predictions side by side.

Quick Comparison: T4 Lysozyme (PDB: 2LZM)

import scirouter
import time

client = scirouter.SciRouter()

# T4 Lysozyme sequence (164 residues)
t4l_sequence = (
    "MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELD"
    "KAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAV"
    "RRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYND"
    "QTPNRAKRVITTFRTGTWDAYKNL"
)

# ESMFold -- fast single-chain prediction
print("Submitting to ESMFold...")
esm_job = client.proteins.fold(
    sequence=t4l_sequence,
    model="esmfold"
)

# Poll ESMFold result
esm_result = client.proteins.fold_result(esm_job.job_id, poll=True)
print(f"ESMFold completed in {esm_result.elapsed_seconds:.1f}s")
print(f"  Mean pLDDT: {esm_result.mean_plddt:.1f}")

# Boltz-2 -- complex-capable prediction
print("\nSubmitting to Boltz-2...")
boltz_job = client.proteins.fold(
    sequence=t4l_sequence,
    model="boltz2"
)

# Poll Boltz-2 result (takes longer due to MSA)
boltz_result = client.proteins.fold_result(boltz_job.job_id, poll=True)
print(f"Boltz-2 completed in {boltz_result.elapsed_seconds:.1f}s")
print(f"  Mean pLDDT: {boltz_result.mean_plddt:.1f}")

# Compare
print(f"\npLDDT difference: {abs(esm_result.mean_plddt - boltz_result.mean_plddt):.1f}")
print(f"Speed ratio: {boltz_result.elapsed_seconds / esm_result.elapsed_seconds:.0f}x")

Batch Screening with ESMFold

For high-throughput variant screening, ESMFold's speed makes it the only practical choice. Here is how to screen a library of point mutations on green fluorescent protein (GFP, PDB: 1EMA):

import scirouter

client = scirouter.SciRouter()

# Wild-type GFP sequence
gfp_wt = (
    "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT"
    "GKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF"
    "KDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNV"
    "YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY"
    "LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)

# Define mutations to screen
positions = [65, 66, 67, 145, 148, 203]  # Key chromophore positions
amino_acids = "ACDEFGHIKLMNPQRSTVWY"

results = []
for pos in positions:
    for aa in amino_acids:
        mutant = gfp_wt[:pos-1] + aa + gfp_wt[pos:]
        job = client.proteins.fold(sequence=mutant, model="esmfold")
        result = client.proteins.fold_result(job.job_id, poll=True)
        results.append({
            "mutation": f"{gfp_wt[pos-1]}{pos}{aa}",
            "plddt": result.mean_plddt,
        })

# Rank by confidence
results.sort(key=lambda x: x["plddt"], reverse=True)
print("Top 10 most confident mutations:")
for r in results[:10]:
    print(f"  {r['mutation']}: pLDDT {r['plddt']:.1f}")

Complex Prediction with Boltz-2

When you need to predict how a protein interacts with a ligand or another protein, Boltz-2 is the tool of choice on SciRouter. Here is how to predict the structure of a protein-ligand complex:

import scirouter

client = scirouter.SciRouter()

# Predict BCL-2 with a small-molecule inhibitor
job = client.complexes.predict(
    model="boltz2",
    protein_sequence=(
        "MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS"
        "SQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA"
        "GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF"
        "FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWI"
    ),
    ligand_smiles="CC1=C(C=C(C=C1)NC(=O)C2=CC=C(C=C2)CN3CCN(CC3)C)NC4=NC=C(C(=N4)C)OC5=CC=CC=C5",
)

result = client.complexes.result(job.job_id, poll=True)
print(f"Complex confidence: {result.confidence:.2f}")
print(f"Interface pLDDT: {result.interface_plddt:.1f}")

with open("complex.pdb", "w") as f:
    f.write(result.pdb)
print("Complex structure saved to complex.pdb")

Decision Tree: Which Tool Should You Use?

Use the following decision tree to select the right protein folding tool for your specific use case:

Choose ESMFold When:

• You need to screen hundreds or thousands of single-chain protein variants
• Speed matters more than marginal accuracy improvements
• You are building an automated pipeline that needs sub-10-second predictions
• You only need single-chain monomer structures (no complexes)
• You want a fully open-source tool with no license restrictions
• You are predicting structures for well-characterized protein families

Choose AlphaFold3 When:

• Maximum accuracy is the top priority and speed is secondary
• You need to predict protein-ligand, protein-DNA, or protein-RNA complexes
• Your work is purely academic (commercial use is restricted)
• You are working on novel folds with very few sequence homologs
• You need predictions for proteins with post-translational modifications

Choose Boltz-2 When:

• You need complex prediction (protein-ligand, protein-protein) with commercial-use rights
• You want AlphaFold3-level accuracy without license restrictions
• You need to predict structures with glycans or covalent modifications
• You are building a commercial drug discovery or biotech pipeline
• You want to self-host or deploy through an API like SciRouter

Protein Embeddings: A Fourth Option for Similarity Search

Beyond structure prediction, ESM-2 (the language model behind ESMFold) also generates protein embeddings – high-dimensional vector representations that capture structural and functional properties. These embeddings are useful for clustering, similarity search, and machine learning features even when you do not need a full 3D structure.

import scirouter

client = scirouter.SciRouter()

# Get embeddings for two related proteins
embedding_1 = client.proteins.embed(
    sequence="MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAK"  # T4 lysozyme
)
embedding_2 = client.proteins.embed(
    sequence="MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLDAAK"  # Single mutation
)

# Compare embeddings
import numpy as np
cos_sim = np.dot(embedding_1.vector, embedding_2.vector) / (
    np.linalg.norm(embedding_1.vector) * np.linalg.norm(embedding_2.vector)
)
print(f"Cosine similarity: {cos_sim:.4f}")  # High similarity expected

Licensing and Commercial Use

Licensing is a critical consideration for commercial applications. Here is the breakdown:

• ESMFold (MIT): Fully permissive. Use commercially, modify, redistribute without restriction.
• AlphaFold3 (Restricted): Academic use only through the AlphaFold Server. Self-hosting requires compliance with DeepMind's model license, which prohibits commercial redistribution.
• Boltz-2 (MIT): Fully permissive. Same freedom as ESMFold for commercial applications.

Infrastructure Requirements

Running these models yourself requires significant GPU resources. Here is what each tool needs for self-hosted deployment:

• ESMFold: A100 40GB (or A10G 24GB for sequences under 400 residues). ~15 GB model weights.
• AlphaFold3: A100 80GB recommended. Requires sequence databases for MSA (2+ TB disk). Total deployment footprint exceeds 3 TB.
• Boltz-2: A100 80GB recommended for complexes. MSA databases add ~2 TB. A40 48GB sufficient for small monomers.

SciRouter abstracts away this infrastructure entirely. You make an API call and get results back – no GPU provisioning, no database downloads, no Docker containers to manage. Predictions are served from pre-warmed RunPod instances with flash boot enabled for minimal cold start times.

Practical Recommendations for 2026

For Academic Research

Academic researchers have the widest range of options. For single-chain structure prediction, start with ESMFold for speed, then validate important predictions with AlphaFold3 through the free AlphaFold Server. For complex prediction, Boltz-2 is the best open-source option, while AlphaFold3 Server handles most use cases with its free tier.

For Drug Discovery Pipelines

Commercial drug discovery teams should standardize on ESMFold for screening and Boltz-2 for complex prediction. Both are MIT-licensed with no usage restrictions. The SciRouter API provides both through a single integration point, which simplifies pipeline development significantly.

For AI Agent Integration

If you are building AI agents that need to call structure prediction tools, ESMFold's speed makes it the natural choice for real-time interactions. SciRouter's MCP server integration exposes both ESMFold and Boltz-2 as callable tools for Claude and other LLM agents.

Next Steps

Ready to start predicting protein structures? Here are three ways to get started:

• Try ESMFold directly in your browser with SciRouter's free tier – no credit card required
• Read the detailed ESMFold tutorial for a step-by-step walkthrough
• Explore Boltz-2 complex prediction for multi-chain and protein-ligand structures

Sign up for a free SciRouter API key and run your first prediction in under a minute. 500 free credits per month, no commitment.