ESMFold vs AlphaFold2: When to Use Which

Two Philosophies of Protein Folding

AlphaFold2 and ESMFold both predict protein structure from amino acid sequences, but they approach the problem from fundamentally different angles. Understanding these architectural differences is the key to knowing when each tool is the right choice.

AlphaFold2 follows the evolutionary paradigm: it gathers information from thousands of related protein sequences via multiple sequence alignments (MSAs), extracts co-evolutionary signals, and uses those signals to constrain structure prediction. ESMFold follows the language model paradigm: it compresses evolutionary knowledge into a pre-trained transformer (ESM-2) during training, then uses that implicit knowledge at inference time without any database search.

This single architectural difference cascades into every practical consideration – speed, accuracy, infrastructure requirements, and which problems each tool handles best.

Architecture Deep Dive

AlphaFold2: MSA + Evoformer

AlphaFold2's pipeline starts before the neural network even runs. It searches sequence databases – UniRef90, MGnify, BFD, and Uniclust30 – using JackHMMER and HHblits to build an MSA of evolutionarily related sequences. This MSA typically contains hundreds to thousands of aligned sequences and encodes which positions co-vary, which indicates spatial proximity in the 3D structure.

The MSA and pair representations flow through the Evoformer, a series of attention blocks that iteratively refine both the sequence-level and pair-level features. Finally, a structure module converts these features into 3D coordinates through iterative coordinate refinement. The entire process is repeated in multiple recycling passes to improve the prediction.

• Input: Amino acid sequence + MSA from database search + template structures
• Key component: Evoformer (48 attention blocks operating on MSA and pair representations)
• Database requirement: 2.5 TB of sequence databases for MSA construction
• Recycling: 3 passes through the network to refine predictions

ESMFold: Language Model + Folding Trunk

ESMFold replaces the entire MSA pipeline with ESM-2, a protein language model with 15 billion parameters trained on 65 million protein sequences via masked language modeling. During training, ESM-2 learns to predict masked amino acids from context, forcing it to internalize evolutionary relationships, structural constraints, and biophysical properties.

At inference time, ESMFold passes the single input sequence through ESM-2 to extract rich per-residue and pairwise features. These features feed into a folding trunk inspired by AlphaFold2's structure module, which predicts 3D coordinates. Because the language model has already captured evolutionary information during pre-training, there is no need for database search at prediction time.

• Input: Amino acid sequence only – nothing else
• Key component: ESM-2 (15B parameter protein language model)
• Database requirement: None at inference time (evolutionary knowledge is learned during training)
• Recycling: 8 folding blocks with single-sequence input

Speed Benchmarks

Speed is where the architectural difference has the most dramatic practical impact. Here are typical wall-clock times for proteins of varying length, measured on standard GPU hardware:

• 100-residue protein: ESMFold ~3 seconds, AlphaFold2 ~5 minutes (MSA search dominates)
• 300-residue protein: ESMFold ~8 seconds, AlphaFold2 ~15 minutes
• 500-residue protein: ESMFold ~15 seconds, AlphaFold2 ~30 minutes
• 1000-residue protein: ESMFold ~45 seconds, AlphaFold2 ~60+ minutes

The gap is not a few percent – it is one to two orders of magnitude. For a single protein, the difference between 10 seconds and 20 minutes may be tolerable. For 10,000 proteins, it is the difference between a few hours and several months.

What Drives AlphaFold2's Latency

It is worth understanding that AlphaFold2's slowness is not primarily the neural network itself – the Evoformer forward pass takes seconds to minutes. The bottleneck is MSA construction. Searching UniRef90, MGnify, and BFD with JackHMMER and HHblits accounts for 70-90% of the total wall-clock time. Some approaches, like ColabFold, use MMseqs2 for faster MSA construction, reducing total time by 10-100x, but this still cannot match ESMFold's single-sequence speed.

Accuracy Comparison

Overall Performance

On the CAMEO (Continuous Automated Model Evaluation) benchmark, which evaluates predictions against newly released experimental structures, AlphaFold2 consistently achieves the highest accuracy. ESMFold follows closely, typically scoring 5-10 GDT-TS points lower when averaged across all targets.

However, this average hides important nuance. The accuracy gap varies significantly depending on the protein:

• Proteins with deep MSAs (many homologs): ESMFold and AlphaFold2 produce nearly identical structures. The difference is often within experimental error.
• Proteins with shallow MSAs (few homologs): AlphaFold2 maintains reasonable accuracy because even a sparse MSA provides useful signal. ESMFold's accuracy drops more noticeably.
• Orphan proteins (no detectable homologs): Both tools struggle, but AlphaFold2 degrades more gracefully because its template search can sometimes find distant structural relatives.
• De novo designed proteins: Neither tool has evolutionary data to draw on. ESMFold can sometimes capture local structural features from its language model knowledge; AlphaFold2's MSA step finds nothing useful.

pLDDT Score Distributions

Both tools report pLDDT confidence scores, but they are calibrated slightly differently. AlphaFold2 pLDDT scores tend to be well-calibrated – a pLDDT of 85 means the prediction is correct at that position about 85% of the time. ESMFold pLDDT scores follow a similar pattern but tend to be slightly more conservative (lower) for equivalent accuracy levels.

In practice, this means an ESMFold prediction with a mean pLDDT of 80 may be roughly as accurate as an AlphaFold2 prediction with a mean pLDDT of 85. Do not compare pLDDT scores directly across tools without accounting for this calibration difference.

Decision Framework

Use this framework to choose between the two tools based on your specific situation:

Choose ESMFold When:

• You need results in seconds, not minutes or hours
• You are screening tens, hundreds, or thousands of sequences
• You want a simple API call without managing databases or GPUs
• Your proteins come from well-studied families with many known homologs
• You need to identify disordered regions quickly (pLDDT as disorder predictor)
• You are building an automated pipeline where latency matters

Choose AlphaFold2 When:

• Maximum single-chain accuracy is critical and you have few targets
• Your proteins are poorly characterized with few known homologs
• You have the infrastructure to host the 2.5 TB database and GPU compute
• You need template-based predictions for distant homologs
• You are characterizing a drug target where structural accuracy directly impacts downstream decisions

Use Both Together:

The most effective strategy for many teams is a two-stage approach. Use ESMFold for rapid initial screening, identify the most promising candidates based on pLDDT and structural features, and then invest AlphaFold2 compute on only those shortlisted proteins.

API Example: Head-to-Head Comparison

Here is how to run an ESMFold prediction through SciRouter's API and compare the result against an AlphaFold Database structure for the same protein:

import requests, time

API_KEY = "sk-sci-your-api-key"
BASE = "https://api.scirouter.ai/v1"
headers = {"Authorization": f"Bearer {API_KEY}"}

# Green fluorescent protein (GFP) - a well-characterized protein
gfp_sequence = (
    "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL"
    "VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVN"
    "RIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHY"
    "QQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
)

# Submit ESMFold prediction
job = requests.post(f"{BASE}/proteins/fold", headers=headers,
                    json={"sequence": gfp_sequence, "model": "esmfold"}).json()

print(f"Job submitted: {job['job_id']}")

# Poll until complete
while True:
    result = requests.get(f"{BASE}/proteins/fold/{job['job_id']}",
                          headers=headers).json()
    if result["status"] == "completed":
        break
    time.sleep(2)

print(f"ESMFold mean pLDDT: {result['result']['mean_plddt']:.1f}")

# Save predicted structure
with open("gfp_esmfold.pdb", "w") as f:
    f.write(result["result"]["pdb_string"])

# Compare against AlphaFold Database structure
# GFP UniProt ID: P42212
af_url = "https://alphafold.ebi.ac.uk/files/AF-P42212-F1-model_v4.pdb"
af_pdb = requests.get(af_url).text
with open("gfp_alphafold.pdb", "w") as f:
    f.write(af_pdb)

print("Both structures saved. Compare in PyMOL with: align gfp_esmfold, gfp_alphafold")

Infrastructure Comparison

Beyond accuracy and speed, the infrastructure requirements differ dramatically and often drive the practical decision:

• AlphaFold2 self-hosted: Requires 2.5 TB of sequence databases, a GPU with at least 16 GB VRAM (A100 recommended), and significant setup effort. Database downloads alone take hours.
• ESMFold self-hosted: Requires only the model weights (~6 GB) and a GPU with 16+ GB VRAM. No databases to download or maintain. Setup takes minutes rather than hours.
• ESMFold via SciRouter API: Requires nothing – no GPU, no storage, no setup. Just an API key and a few lines of code. See the ESMFold tool page for endpoint details.

For teams without dedicated ML infrastructure, the API approach removes all infrastructure barriers. For teams with existing GPU clusters, ESMFold's minimal dependencies make it far easier to deploy than AlphaFold2.

What About Boltz-2?

If your work involves protein complexes, neither ESMFold nor AlphaFold2 may be sufficient on their own. Boltz-2 handles multi-chain prediction including protein-protein, protein-ligand, and protein-nucleic acid complexes. It fills the gap that both ESMFold (single-chain only) and AlphaFold2 (complex support via Multimer is limited) leave open. Read our ESMFold deep dive for more on single-chain prediction fundamentals, or our three-way comparison for the full picture including Boltz-2.

The Bottom Line

ESMFold and AlphaFold2 are not competitors – they are complementary tools optimized for different points on the speed-accuracy trade-off curve. ESMFold gives you fast, good-enough predictions for high-throughput work. AlphaFold2 gives you maximum accuracy when you can afford the compute and latency. The best approach for most teams is to use both: ESMFold for screening, AlphaFold2 for the final targets that matter most.

Get started with ESMFold predictions through SciRouter's API – sign up for a free key and submit your first sequence in under a minute. No databases, no Docker, no GPU setup required.