AlphaFold Alternatives: 7 Tools You Should Know

Why Look Beyond AlphaFold?

AlphaFold changed structural biology forever. When DeepMind's model dominated CASP14 in 2020, it solved a problem that had stumped researchers for fifty years. The AlphaFold Protein Structure Database now contains predicted structures for over 200 million proteins. So why would anyone need an alternative?

Three practical reasons push researchers beyond AlphaFold. First, speed: AlphaFold2 requires multiple sequence alignments (MSAs) that can take minutes to hours to compute. For high-throughput screening of thousands of sequences, this bottleneck is prohibitive. Second, access and licensing: AlphaFold3 introduced commercial restrictions that limit how pharmaceutical companies and biotech startups can use predictions. Third, specialized capabilities: AlphaFold2 was designed for single-chain monomeric proteins. Predicting protein-ligand complexes, protein-DNA interactions, or antibody-antigen binding requires tools purpose-built for those tasks.

This guide covers seven alternatives worth knowing – each with distinct strengths for different research workflows.

1. ESMFold: 60x Faster, Single Sequence

ESMFold is Meta AI's protein structure prediction model, published in 2022. Its defining innovation is eliminating the MSA step entirely. Instead of searching sequence databases for homologs, ESMFold feeds the raw amino acid sequence through ESM-2 – a 15-billion-parameter protein language model – and predicts the 3D structure directly from the learned representations.

The result is dramatic speed improvement. ESMFold produces a structure prediction in seconds, compared to minutes or hours for AlphaFold2. For a 300-residue protein, typical inference time is under 10 seconds on a single GPU. This makes ESMFold the tool of choice for screening workflows where you need to fold hundreds or thousands of sequences quickly.

• Best for: High-throughput screening, rapid triage, metagenomic sequences
• Accuracy: Slightly below AlphaFold2 for well-studied families; comparable for orphan proteins
• Speed: ~60x faster than AlphaFold2
• License: MIT (fully open)
• Input: Single amino acid sequence (no MSA required)

2. Boltz-2: Open-Source Complex Prediction

Boltz-2 is a biomolecular structure prediction model from MIT, released under the MIT license. Where AlphaFold2 focuses on individual protein chains, Boltz-2 predicts the structures of complexes – proteins bound to other proteins, small-molecule ligands, DNA, RNA, or antibody-antigen pairs.

Boltz-2 matches or exceeds AlphaFold3 on several benchmarks for complex prediction, and its open-source license is a decisive advantage for commercial drug discovery. AlphaFold3's terms restrict commercial use, making Boltz-2 the preferred option for biotech companies that need to predict how a drug candidate binds to its protein target.

• Best for: Protein-ligand complexes, protein-protein interactions, antibody-antigen binding
• Accuracy: Comparable to AlphaFold3 for complexes
• Speed: Minutes per complex (GPU required)
• License: MIT (unrestricted commercial use)
• Input: Multiple chains, ligand SMILES, nucleic acid sequences

3. RoseTTAFold: The Baker Lab Workhorse

RoseTTAFold was developed by David Baker's laboratory at the University of Washington – the same group that created Rosetta, the most widely used protein modeling software in history. RoseTTAFold uses a "three-track" architecture that simultaneously processes sequence information, distance maps, and 3D coordinates, allowing the three representations to exchange information during prediction.

While slightly less accurate than AlphaFold2 for monomeric proteins, RoseTTAFold excels at protein-protein complex prediction through its RoseTTAFold2 and RoseTTAFoldNA variants. It is also the foundation for protein design tools like RFdiffusion, making it central to the protein engineering ecosystem.

• Best for: Protein-protein complexes, integration with Rosetta design tools
• Accuracy: Close to AlphaFold2 for monomers; strong for complexes
• Speed: Similar to AlphaFold2 (requires MSA)
• License: BSD (permissive open-source)
• Input: Amino acid sequence + MSA

4. OmegaFold: Single Sequence from Meta

OmegaFold, developed at Helixon (with contributors from Meta), takes a similar approach to ESMFold: predicting structure from a single sequence without MSA. It uses a combination of a protein language model and a geometry module to generate 3D coordinates.

OmegaFold was published around the same time as ESMFold, and the two models offer comparable performance on many benchmarks. OmegaFold tends to perform slightly better on short peptides and disordered regions, while ESMFold has the edge on longer, well-structured proteins. Both are excellent choices when speed matters more than maximizing accuracy.

• Best for: Single-sequence prediction, peptides, speed-critical workflows
• Accuracy: Comparable to ESMFold; slightly better on short sequences
• Speed: Fast (no MSA required)
• License: Apache 2.0 (permissive)
• Input: Single amino acid sequence

5. ColabFold: Free Browser-Based AlphaFold

ColabFold is not a new model – it is a highly optimized wrapper around AlphaFold2 that runs in a free Google Colab notebook. Its key innovation is replacing the slow MSA generation step with MMseqs2, which is orders of magnitude faster than the original jackhmmer-based pipeline. This reduces total prediction time from hours to minutes.

For researchers who want AlphaFold2-level accuracy without setting up local GPU infrastructure, ColabFold is the most accessible option. The trade-off is that Google Colab has usage limits, and heavy users may be throttled or disconnected. For production workloads, an API-based approach is more reliable.

• Best for: Quick one-off predictions, educational use, teams without GPU access
• Accuracy: AlphaFold2-level (it runs AlphaFold2)
• Speed: ~5x faster than standard AlphaFold2 (thanks to MMseqs2)
• License: Apache 2.0
• Input: Amino acid sequence (MSA generated automatically)

6. OpenFold: Open-Source AlphaFold2 Reproduction

OpenFold is a faithful, independently trained reproduction of AlphaFold2, created by a consortium including Columbia University, Harvard, and several pharmaceutical companies. It achieves accuracy equivalent to AlphaFold2 while being fully open-source with permissive licensing.

The primary audience for OpenFold is researchers and companies that need to modify the model itself – fine-tuning on proprietary data, changing the architecture, or integrating predictions into custom pipelines. If you just need predictions, AlphaFold2 or ESMFold will serve you well. If you need to build on top of the model, OpenFold gives you the flexibility that DeepMind's codebase does not.

• Best for: Custom model development, fine-tuning, research on model internals
• Accuracy: Equivalent to AlphaFold2
• Speed: Similar to AlphaFold2 (same architecture)
• License: Apache 2.0 (fully open, trainable)
• Input: Amino acid sequence + MSA

7. SciRouter: Unified API Access to Multiple Tools

SciRouter is not a single model – it is a unified API gateway that gives you access to ESMFold, Boltz-2, and other scientific computing tools through one API key and a consistent interface. Instead of provisioning separate GPU instances for each model, you send requests to a single endpoint and SciRouter handles the infrastructure.

This approach is particularly valuable when your workflow spans multiple tools. For example, you might fold a protein with ESMFold, predict its complex with a ligand using Boltz-2, then calculate the ligand's molecular properties – all through the same API.

• Best for: Multi-tool workflows, production pipelines, teams that do not want to manage GPU infrastructure
• Models available: ESMFold, Boltz-2, and growing
• Free tier: 5,000 API calls/month
• Access: REST API, Python SDK, MCP server for AI agents

Comparison Table

Here is a side-by-side comparison of all seven tools across the dimensions that matter most for practical research:

Predicting Protein Structure via API

Here is how to fold a protein using ESMFold through SciRouter's API – no GPU setup, no MSA generation, no environment configuration:

import requests

API_KEY = "sk-sci-your-api-key"
BASE = "https://api.scirouter.ai/v1"

# Human insulin B chain
sequence = "FVNQHLCGSHLVEALYLVCGERGFFYTPKT"

response = requests.post(
    f"{BASE}/proteins/fold",
    headers={"Authorization": f"Bearer {API_KEY}"},
    json={
        "sequence": sequence,
        "model": "esmfold"
    }
)

result = response.json()
print(f"Model: {result['model']}")
print(f"Confidence (pLDDT): {result['mean_plddt']:.1f}")
print(f"PDB length: {len(result['pdb_string'])} characters")

# Save the predicted structure
with open("insulin_b_chain.pdb", "w") as f:
    f.write(result["pdb_string"])

print("Structure saved to insulin_b_chain.pdb")

The same API key gives you access to Boltz-2 for complex prediction:

import requests

API_KEY = "sk-sci-your-api-key"
BASE = "https://api.scirouter.ai/v1"

# Predict complex: protein + small molecule ligand
response = requests.post(
    f"{BASE}/proteins/complex",
    headers={"Authorization": f"Bearer {API_KEY}"},
    json={
        "protein_sequence": "FVNQHLCGSHLVEALYLVCGERGFFYTPKT",
        "ligand_smiles": "CC(=O)Oc1ccccc1C(=O)O",
        "model": "boltz2"
    }
)

complex_result = response.json()
print(f"Model: {complex_result['model']}")
print(f"Confidence: {complex_result['confidence']:.2f}")
print(f"Binding interface residues: {complex_result['interface_residues']}")

Choosing the Right Tool for Your Workflow

The best AlphaFold alternative depends on what you are trying to accomplish:

• Screening thousands of sequences – Use ESMFold for its unmatched speed. Fold first, then run detailed analysis on the most promising candidates.
• Predicting drug-target binding – Use Boltz-2 for protein-ligand complex prediction with an open license.
• Maximum accuracy on a single protein – Use ColabFold (free) or OpenFold (self-hosted) to get AlphaFold2-level accuracy.
• Protein design and engineering – Use RoseTTAFold for its integration with the Rosetta protein design ecosystem.
• Production API with multiple tools – Use SciRouter for a unified interface that spans folding, docking, and molecular properties.

For a broader comparison of protein folding tools, see our ranking of the best protein folding tools in 2026. For a focused head-to-head, read ESMFold vs AlphaFold: When to Use Which.

Next Steps

The protein structure prediction landscape has expanded well beyond AlphaFold. Whether you need speed (ESMFold), complex prediction (Boltz-2), accessibility (ColabFold), or flexibility (OpenFold), there is a tool built for your use case.

Ready to try these tools? Sign up for a free SciRouter API key and start folding proteins in seconds. The free tier includes 5,000 API calls per month – enough to explore every tool on this list.